SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003263 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003263
Domain Number 1 Region: 104-211
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 285-325
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000122
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0076
Further Details:      
 
Domain Number 4 Region: 212-252
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000353
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003263   Gene: ENSPPYG00000002794   Transcript: ENSPPYT00000003371
Sequence length 497
Comment pep:novel chromosome:PPYG2:10:133183204:133193998:1 gene:ENSPPYG00000002794 transcript:ENSPPYT00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLPPGHTEARLVGGEHPCAGRLEVRRGLTWGTVCDADLDLATAHVVCRELQCGAVVSTPE
GARFCRGSGPVWTETSRCAGNESLLFLHPRGRGSPCGPGRDAGLRCFRLVNGSSSCEGHV
ELQVQGSWAPLCATHWDIADATVLCHQLNCGNAVAAPRGGHFGDGDAAVWPDAFHCEGTE
PHLWNCPVSTLGAPACAPGNSASAVCSGLPHALRLREGQSRCDGRVEVSLDGVWGRVLDD
AWDLRGAGVVCTASPVARRRRVPGALILSLHREPQGAAGRGAGALHGGAWGTVCDDAWDL
RDAHVVCRQLGCGRALSLGGRPLRSRGRAHLAGRAGVPGPRVCAVAVPIGGLGPARLQAQ
GGRRRLLLAAGSFLQWDLGWGAPQLLLLARLPRGGRTARARGRGPLLRARGALARGLLGH
RVRRWLGPGRRGGRVPPAGLWSGRRRPGGRRLWPWLRARVAGRGGVPGQRGVPVGLPRSG
GDAEAARTRRTRAAGKT
Download sequence
Identical sequences H2NC32
ENSPPYP00000003263 9600.ENSPPYP00000003263 ENSPPYP00000003263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]