SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003314 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003314
Domain Number 1 Region: 71-179
Classification Level Classification E-value
Superfamily vWA-like 2.7e-17
Family Integrin A (or I) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003314   Gene: ENSPPYG00000002848   Transcript: ENSPPYT00000003427
Sequence length 477
Comment pep:known_by_projection chromosome:PPYG2:10_random:38373864:38417643:1 gene:ENSPPYG00000002848 transcript:ENSPPYT00000003427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSHGSRGPYFLVFLLLLLLPPPLFRAGSLQYHGPDWRIFHRLALGTRRAHHRHGPGWRQ
HWRQGQAGHRCQGSFDLYFILDKSGSVNNNWIDLYMWVEETVARFQSPNIRMCFITYSTD
GETVLPLTSDKVPSMIIAMTDGELVAHAFKDTLREAQNARKLGANVYTLGVADYNLDQPC
HVIIHGNGFQNLKKQDEVICRFIFNESTIIDEKPTSIDNNSMNCPGPKLEKPGEEYSIEV
SLNKGKTFFKSNVNITSTTCGIFRNWLYFVPLLLLVPLLLCCVWRLCRKKTVKEPPPVQK
PEKEPEQEKPPSPPPPPPPPPPPPPPPPPAPVNTCPTVIVCCCGCQGVCGMRRIEGNLDT
FCDLSHPSCRQVPWMWCQHRDQGRYLSLALAQSQYAQAPCCPRICFPHSQEPKDVPETQP
GVLFPSTDSVQPEELPSTQPGVPRCCRCCPHCSGTLQNPLCHSPPQSPTSKAPNTQD
Download sequence
Identical sequences H2NC81
ENSPPYP00000003314 9600.ENSPPYP00000003314 ENSPPYP00000003314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]