SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003409 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003409
Domain Number 1 Region: 25-420
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.28e-46
Family LacY-like proton/sugar symporter 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003409   Gene: ENSPPYG00000002936   Transcript: ENSPPYT00000003529
Sequence length 424
Comment pep:known_by_projection chromosome:PPYG2:11:4141150:4164898:1 gene:ENSPPYG00000002936 transcript:ENSPPYT00000003529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGARAPRDQGQSPGRMSALGRSSVILLTYVLAAIELTCLFMQFSVVPYLSRKLGLDSIA
FGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAALALYLLLAAASSPALPGVYLL
FASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLGLCFGVGVILGSLLGGTLVSAYGI
QCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDV
PRIFLVKVASNFPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSS
HFSEEALLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCALNVVTDSMLTKAVSSS
DTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQVAINTLVLLVLWRKPMPQRK
DKVR
Download sequence
Identical sequences H2NCH5
ENSPPYP00000003409 ENSPPYP00000003409 XP_002821433.1.23681 XP_002821434.1.23681 9600.ENSPPYP00000003409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]