SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003419 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003419
Domain Number 1 Region: 364-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 476-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 197-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-16
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 6 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000166
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 241-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000833
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003419
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000131
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003419   Gene: ENSPPYG00000002946   Transcript: ENSPPYT00000003540
Sequence length 574
Comment pep:known_by_projection chromosome:PPYG2:11:4585230:4599429:-1 gene:ENSPPYG00000002946 transcript:ENSPPYT00000003540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLFSIGLTVSKPGLITCLEQRKEPWNVKRQEAVDGHPEMGFHHTTQACLELLGS
SDLPASASQSAGITGVNHRAQPGLNVSVDKFTAVSSHFTQDLLPEQGIQDAFPKTILRGY
GNCGLDNLYLRKDWESLDEYKLQKDYNGLNQCSSTTHSKIFQCNKYVKIFDNFSNLHKCN
ISNIGEKPFKCQECGKSFQMFSFLTEHQKIHTGKKFQKCGECGKTFIQCSHFTEHENIDT
GEKPYKCQECDNVIKTCSVLTKNRIYTGGEHYRCEEFGRVFNQCSHLTEHERGTEEKPCK
YEECSSVFISCSSLSNQQMILAGEKLSKCETWYKGFNHGPNPSKHQRNEIGGKPFKCEEC
DSIFKWFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCEECGKVF
RTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSS
NLIVHKRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCEECGKNFTQSSNLIV
HKRIHTGEKPYKCEKCGKAFTQFSHLTVHESIHT
Download sequence
Identical sequences H2NCI5
ENSPPYP00000003419 ENSPPYP00000003419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]