SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003528 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003528
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 89-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000148
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003528
Domain Number - Region: 183-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0119
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003528   Gene: ENSPPYG00000003049   Transcript: ENSPPYT00000003655
Sequence length 239
Comment pep:known_by_projection chromosome:PPYG2:11:10098358:10101545:-1 gene:ENSPPYG00000003049 transcript:ENSPPYT00000003655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLSPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMG
HLTGPQSRDHGFLRTKMKVTLGDSPSGDLFTCHICQKAFTYQRMLNRHMKCHNDVKRHLC
TYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKER
RAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Download sequence
Identical sequences H2NCU1
9600.ENSPPYP00000003528 ENSPPYP00000003528 ENSPPYP00000003528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]