SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003589 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000003589
Domain Number - Region: 166-233
Classification Level Classification E-value
Superfamily t-snare proteins 0.0102
Family t-snare proteins 0.0044
Further Details:      
 
Domain Number - Region: 31-73
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 87-150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003589   Gene: ENSPPYG00000003105   Transcript: ENSPPYT00000003718
Sequence length 414
Comment pep:known_by_projection chromosome:PPYG2:11:11611806:11619593:-1 gene:ENSPPYG00000003105 transcript:ENSPPYT00000003718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQGLSLQLRQGPSGLGPKMCAEPRLVETQNVRLIEVERSNATLVAEKAALQGQLQHLE
GQLGSLQGRAQELLLAERERLMQDGHRQRGLEEELRRLQSEHDRAQMLLAEVSRERGELQ
GERGELRGRLARLELERAQLEMQSQQLRESNQQLDLSACRLTTQCELLTQLRSAQEEENR
QLLAEVQALSRENREFLRERSLESRDHLHRERREYLDQLNALRREKQKLVEKIMDQYRVL
EPGPLPRTKKGSWLADKVKRLMRPRREGGPPGGLRLGADGAGSTESLGGPPETELPEGRE
ADGTGSPSPAPMRRAQSSLCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQR
RPGPLGAPISHSKGPGVGWENSAETLQEHETDASREGPEVQEPEKRPLTPSLSQ
Download sequence
Identical sequences H2NCZ7
ENSPPYP00000003589 ENSPPYP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]