SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003654 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003654
Domain Number 1 Region: 405-580
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.02e-32
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.037
Further Details:      
 
Domain Number 2 Region: 158-234,338-401
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.07e-27
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.062
Further Details:      
 
Domain Number 3 Region: 54-133
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000597
Family Canonical RBD 0.0042
Further Details:      
 
Domain Number 4 Region: 5-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000217
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003654   Gene: ENSPPYG00000003162   Transcript: ENSPPYT00000003783
Sequence length 873
Comment pep:known chromosome:PPYG2:11:13583448:13601325:1 gene:ENSPPYG00000003162 transcript:ENSPPYT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFV
SGFPRDVDSAQLSEYFQAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHRLGGHR
LRVRPREQKEFQSPASKSPKGAAPDSHQLARALAEAADVGAQMIKLVGLRELSEAERQLR
SLVVALMQEVFTEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGDLEEPQPVPKAPESPS
LDSALASPLDPQALACTPASPPDSQPPASPQDSEALDFETPSSSLAPQTPDSALASETLA
SPQSLPPASPLLEDREEGDLGKAPELAETPKQEKAEGAAMLELVGSILRGCVPGVYRVQT
VPSARRPVVKFCHRPSGLHGDVSLSNRLALHNSRFLSLCSELDGRVRPLVYTLRCWAQGR
GLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSELTQKAGEGEQVEVDGWDCSFPRDAS
RLEPSTNVEPLSSLLAQFFSCVSCWDLRGSLLSLREGQALPVAGGLPSNLWEGLRLGPLN
LQDPFDLSHNVAANVTSRVAGRLQNCCRAAANYCRSLQYQHRSSRGRDWGLLPLLQPSSP
SSLLSATPIPLPPAPFTQLTAALVQVFREALGCHIEQGTKRPRSEGGGTGESSQGGTSKR
LKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMVQDWAMQSPGQPGDLPLTTGK
HGAPGEERQPSHAALAERGPKGHEAAQGGSQGEAGKGASLPSVSWRCALWHRVWQGRRRA
RRRLQQQTKEGAGGGVGTRAGWLATEAQVTQELRGLSGGEERPETEPLLSFVASVSPADR
MLTVTPLQDPQGLFPDLHHFLQVFLPQALRHLK
Download sequence
Identical sequences H2ND59
ENSPPYP00000003654 ENSPPYP00000003654 9600.ENSPPYP00000003654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]