SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003687 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003687
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0098
Further Details:      
 
Domain Number 2 Region: 271-371
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000575
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003687
Domain Number - Region: 165-270
Classification Level Classification E-value
Superfamily SRCR-like 0.000314
Family Hepsin, N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003687   Gene: ENSPPYG00000003197   Transcript: ENSPPYT00000003819
Sequence length 375
Comment pep:known_by_projection chromosome:PPYG2:11:15225720:15270231:-1 gene:ENSPPYG00000003197 transcript:ENSPPYT00000003819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMGSPQPLATLYLLGMLVASCLGRLSWYDADFQARLTRSNSKCQGQLEVYIKDRWHMVC
SQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGSWHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAATAQDPGEPREHRPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSFRSSLRWEEVCREQQCGGVNSYRVLDTGDPTSRGLSCPHQKLSQCHELCERNSYC
KKVFVTCEGPNPSGL
Download sequence
Identical sequences H2ND90
ENSPPYP00000003687 ENSPPYP00000003687 9600.ENSPPYP00000003687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]