SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003688 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003688
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 261-364
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 3 Region: 41-157
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003688   Gene: ENSPPYG00000003198   Transcript: ENSPPYT00000003820
Sequence length 665
Comment pep:known_by_projection chromosome:PPYG2:11:15359147:15421185:-1 gene:ENSPPYG00000003198 transcript:ENSPPYT00000003820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFFGIAGLLMAALSGHPSPAPSDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPKLPPPPAAGNTSAAANAT
LAGAPALLCSGAELQLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGVVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYSSEAK
VLCQSLGCGTAVEWPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPPSVQTVTIESSVTVKIENKESRELMLLIPSIVLGVLFLGSLIFIA
FIFLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPTQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPAA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKPPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFAAGPSADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGANIWGRDLGGGQ
RGTGE
Download sequence
Identical sequences H2ND91
ENSPPYP00000003688 ENSPPYP00000003688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]