SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003689 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003689
Domain Number 1 Region: 24-132,162-258,301-564
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-20
Family LacY-like proton/sugar symporter 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003689   Gene: ENSPPYG00000003199   Transcript: ENSPPYT00000003821
Sequence length 582
Comment pep:known_by_projection chromosome:PPYG2:11:15477573:15495654:1 gene:ENSPPYG00000003199 transcript:ENSPPYT00000003821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPCAREQPRVPGERQPLMPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLFL
NSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPA
TAFPDGRSSFCGEMPASPLGPACPSAGCPRAPSPSPYCAPVLYAGLLLLGLAASSVRSNL
TSFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGL
AFFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHLARDRQGARLLADQRSPQP
GASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISM
ALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGF
TSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPG
LEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPEDFGNINNCRMD
LYFFLLAGIQAVTALLFVWIAGRYERASQGPASHSCFSRDRG
Download sequence
Identical sequences H2ND92
XP_002821745.1.23681 ENSPPYP00000003689 ENSPPYP00000003689 9600.ENSPPYP00000003689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]