SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003961 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003961
Domain Number 1 Region: 108-170
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.07e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003961   Gene: ENSPPYG00000003449   Transcript: ENSPPYT00000004112
Sequence length 319
Comment pep:known_by_projection chromosome:PPYG2:11:52406014:52407741:-1 gene:ENSPPYG00000003449 transcript:ENSPPYT00000004112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLSPPIRDVDQTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMQVGALLKPE
EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR
RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA
PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYEAPSEPRPG
KSAAVSSLDCLSSIVERISTQSPAAPALLLADVPSESPPRRQEAAAPSEEESSGDPTQSP
DTAPQCPAGANPNPIYQVL
Download sequence
Identical sequences H2NDZ8
ENSPPYP00000003961 9600.ENSPPYP00000003961 ENSPPYP00000003961 XP_002822038.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]