SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003972 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003972
Domain Number 1 Region: 606-684
Classification Level Classification E-value
Superfamily HMG-box 2.62e-26
Family HMG-box 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003972   Gene: ENSPPYG00000003459   Transcript: ENSPPYT00000004123
Sequence length 814
Comment pep:known chromosome:PPYG2:11:53736992:54134644:1 gene:ENSPPYG00000003459 transcript:ENSPPYT00000004123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSSEVLADVVRESRIEDWKSSHFIRMSSKQATSPFACAADGEDAMTQDLTSREKEEGS
DQHVASHLPLHPIMHNKPHSEELPTLVNTIQQDADWDSVLSSQQRMESENNKLCSLYSFR
NTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQEDPSCM
EKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLISLREQLLAAHDEQK
KLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFP
HDQRTLAAAAAAQQGFLFPPGITYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQL
ASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTA
EPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALFGDQD
TVMKAIQEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNNCRNEKERTRFENLGPQLT
GKSNEDGKLGPGVIDLTRPEDAEGDKAMNGSAAKLQQYYCWPTGGATVAEARVYRDARGR
ASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQ
ARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIP
ITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTYGMKTDGGSLAGNEM
INGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN
Download sequence
Identical sequences H2NE09
ENSPPYP00000003972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]