SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003981 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003981
Domain Number 1 Region: 737-792
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000432
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 681-737
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000759
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 792-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 628-678
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000112
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 881-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 570-616
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000876
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003981   Gene: ENSPPYG00000003469   Transcript: ENSPPYT00000004134
Sequence length 934
Comment pep:known_by_projection chromosome:PPYG2:11:55850757:56159532:-1 gene:ENSPPYG00000003469 transcript:ENSPPYT00000004134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRFLRQTLGIQRRKINTAAPLIASSEETKQRCAGGSGQNQPSLLPLLRRGPPLLALLSF
AWLSSAQLSAAPRPPSRGGHGLPVADAGSELPLSAAPPPGRAFVGTISGRSRVAKAGGRG
TKLGAARMRLSPATLKLSRTPALLALALPLAAALAFSDETLDKVPKSEGYCSRILRAQGT
RREGYTEFSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALKENREGDKEEDHAGT
FQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQD
EGSLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSA
IIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQ
PLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPW
DAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGE
QCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQ
LDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPE
DGSVCTLPTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKKRHRMIKMSPADGS
MCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNED
LEQVEKCMLPECPIDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQFGGAPCPETVQRK
KCRIRKCLRNPSIQKLRWREARESRRSEQLKEESEGEQFPGCRMRPWTAWSECTKLCGGG
IQERYMTVKKRFKSSQFTSCKDKKEIRACNVHPC
Download sequence
Identical sequences H2NE18
ENSPPYP00000003981 ENSPPYP00000003981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]