SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003993 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003993
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-38
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 
Domain Number 3 Region: 994-1027
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000342
Family LIM domain 0.0093
Further Details:      
 
Domain Number 4 Region: 1028-1057
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000884
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003993   Gene: ENSPPYG00000003477   Transcript: ENSPPYT00000004146
Sequence length 1124
Comment pep:known_by_projection chromosome:PPYG2:11:57931342:58079197:-1 gene:ENSPPYG00000003477 transcript:ENSPPYT00000004146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPR
KRTPRVDGQTGENDMNKRRRKGFNNLDEPSNFSSLSLGSNQECGSSKEGGNQNKVKSMAN
QLLAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATPSPSPPLKRQF
PSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVL
WRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLPSKGLSHTHPS
SPPSCLPSPDPAASSSPSTVDSASPARKEKKSPSGFHFHPSHFRTVHPQLTVGKVSSGIG
AAAEVLVNLYMNDHRPKAQATSPDLESMRKSFPLNLGGSDMCYFCKKRVYVMERLSAEGH
FFHRECFRCSVCATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEA
TWQEQEAPRRDTPTESSCAVAAIGTPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences H2NE29
ENSPPYP00000003993 ENSPPYP00000003993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]