SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003999 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003999
Domain Number 1 Region: 271-664
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000091
Family Hermes transposase-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000003999
Domain Number - Region: 121-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003999   Gene: ENSPPYG00000003484   Transcript: ENSPPYT00000004154
Sequence length 693
Comment pep:known_by_projection chromosome:PPYG2:11:59366730:59368811:1 gene:ENSPPYG00000003484 transcript:ENSPPYT00000004154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSES
NDQKVGILQSEDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFT
YFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKP
PTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDA
VQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKS
IEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLI
KYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMG
AQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADI
FTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINST
VDKDICSAIVQHLRGLHSTLLKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTS
DSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRK
RLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH
Download sequence
Identical sequences H2NE35
9600.ENSPPYP00000003999 ENSPPYP00000003999 ENSPPYP00000003999 XP_002822075.1.23681 XP_003777858.1.23681 XP_009244894.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]