SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004017 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004017
Domain Number 1 Region: 94-163
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.72e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004017   Gene: ENSPPYG00000003501   Transcript: ENSPPYT00000004173
Sequence length 181
Comment pep:known_by_projection chromosome:PPYG2:11:61347583:61348128:1 gene:ENSPPYG00000003501 transcript:ENSPPYT00000004173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDNRGNSGLPDKLPIFPDSAHLPLTRSFYLEPMVTFHVHPEAPVPSPYSEELPLLPFPS
DSLIPGNYSEPCPFSFPMPYPNYRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRI
V
Download sequence
Identical sequences H2NE53
XP_002822095.1.23681 ENSPPYP00000004017 ENSPPYP00000004017 9600.ENSPPYP00000004017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]