SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004105 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004105
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 4.52e-55
Family Globins 0.000000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004105   Gene: ENSPPYG00000003582   Transcript: ENSPPYT00000004271
Sequence length 147
Comment pep:novel chromosome:PPYG2:11:65209995:65211431:1 gene:ENSPPYG00000003582 transcript:ENSPPYT00000004271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFTEEDKATITSLWGKLNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVTGVASALSSRYH
Download sequence
Identical sequences H2NED8
9600.ENSPPYP00000004105 ENSPPYP00000004105 ENSPPYP00000004105 XP_002822174.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]