SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004106 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004106
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Globin-like 2.53e-55
Family Globins 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004106   Gene: ENSPPYG00000003583   Transcript: ENSPPYT00000004272
Sequence length 147
Comment pep:novel chromosome:PPYG2:11:65214894:65216335:1 gene:ENSPPYG00000003583 transcript:ENSPPYT00000004272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFTEEDKATITSLWGKLNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSLGDAVKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIHFG
KEFTPEVQASWQKMVAGVASALSSRYH
Download sequence
Identical sequences H2NED9
XP_002822176.1.23681 ENSPPYP00000004106 ENSPPYP00000004106 9600.ENSPPYP00000004106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]