SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004175 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004175
Domain Number 1 Region: 579-935
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.47e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 392-574
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 223-405
Classification Level Classification E-value
Superfamily GAF domain-like 9.53e-34
Family GAF domain 0.0000000196
Further Details:      
 
Domain Number 4 Region: 44-195
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000113
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004175   Gene: ENSPPYG00000003652   Transcript: ENSPPYT00000004346
Sequence length 939
Comment pep:known_by_projection chromosome:PPYG2:11:67922388:68021634:-1 gene:ENSPPYG00000003652 transcript:ENSPPYT00000004346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPQPCADSLQDALLSLGSVIDIS
GLQRAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELPQEGKVREAIICRKRLGCNG
LGFSDLPGKPLARLVAPLAPDTQVLVMPLVKEAGAVAAVILVHCGQLRDSEEWSLQAVEK
HTLVALRRVQALQQRGPREAPRAVQNPPEGAAEDQKGGAAYTDRDRKILQLCGELYDLDA
SSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVED
KKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDED
EQVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEAR
NLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAY
AHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSI
YCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFAS
FTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAF
SVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSE
GSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQK
MAQVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGN
RPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKF
TIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences H2NEK5
ENSPPYP00000004175 9600.ENSPPYP00000004175 ENSPPYP00000004175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]