SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004186 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004186
Domain Number 1 Region: 12-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.71e-58
Family G proteins 0.0000000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004186   Gene: ENSPPYG00000003663   Transcript: ENSPPYT00000004357
Sequence length 208
Comment pep:known chromosome:PPYG2:11:69048594:69137836:-1 gene:ENSPPYG00000003663 transcript:ENSPPYT00000004357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
QDRSREDMIDIKLEKPQEQPVSEGGCSC
Download sequence
Identical sequences A0A024R5J5 A0A2I2ZAB8 A0A2I3RF53 A0A2J8V1J1 P20340 Q5RAV6
ENSP00000336850 ENSPPYP00000004186 ENSPPYP00000004186 NP_001125644.1.23681 NP_942599.1.87134 NP_942599.1.92137 XP_003814713.1.60992 XP_016777070.1.37143 XP_018892170.1.27298 gi|38679888|ref|NP_942599.1| ENSP00000336850 ENSP00000336850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]