SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004237 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004237
Domain Number 1 Region: 262-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-87
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004237
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0405
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004237   Gene: ENSPPYG00000003708   Transcript: ENSPPYT00000004409
Sequence length 546
Comment pep:known_by_projection chromosome:PPYG2:11:72808929:72904154:-1 gene:ENSPPYG00000003708 transcript:ENSPPYT00000004409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNT
EKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIK
QMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTET
CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS
KRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATN
GTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKE
ATKNNH
Download sequence
Identical sequences A0A2K6V2G6 H2NER3 U3EH84
9600.ENSPPYP00000004237 ENSPPYP00000004237 XP_003943013.1.74449 XP_009245133.1.23681 XP_010329111.1.74449 XP_012325019.1.9421 XP_012325020.1.9421 XP_012325021.1.9421 XP_012325022.1.9421 XP_012325023.1.9421 XP_012325024.1.9421 ENSPPYP00000004237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]