SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004244 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004244
Domain Number 1 Region: 34-129
Classification Level Classification E-value
Superfamily POZ domain 3.73e-25
Family Tetramerization domain of potassium channels 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004244   Gene: ENSPPYG00000003716   Transcript: ENSPPYT00000004417
Sequence length 256
Comment pep:known_by_projection chromosome:PPYG2:11:73507658:73514545:-1 gene:ENSPPYG00000003716 transcript:ENSPPYT00000004417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRQGCAVERPEGRMTSQTPLPQSPRPRRPTMSTVVELNVGGEFHTTTLGTLRKFPGSKL
AEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQYYEIKPLV
KLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQD
AYYSEVLCFLQDKKMFKSVVKFGPWKAVLDSSDLMHCLEMDIKAQGYKVFSKFYLMYPTK
RNEFHFNIYSFTFTWW
Download sequence
Identical sequences H2NES0
ENSPPYP00000004244 9600.ENSPPYP00000004244 ENSPPYP00000004244 XP_002822329.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]