SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004257 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004257
Domain Number 1 Region: 1254-1593
Classification Level Classification E-value
Superfamily NHL repeat 6.02e-23
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1493-1731
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000785
Family Serum paraoxonase/arylesterase 1, PON1 0.091
Further Details:      
 
Domain Number 3 Region: 949-1020
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000549
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 658-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004257
Domain Number - Region: 788-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000228
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 691-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000411
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 758-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 824-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 624-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00472
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004257   Gene: ENSPPYG00000003726   Transcript: ENSPPYT00000004430
Sequence length 2794
Comment pep:known_by_projection chromosome:PPYG2:11:74183153:74752268:-1 gene:ENSPPYG00000003726 transcript:ENSPPYT00000004430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPDHSALSAARTLFVDVEERGPEAMDVKERKPYRSLTRRRDTERRYTSSSADSEEGKAP
QKSYSSSETLKAYDQDTRLAYGSRVKDIVPQEAEEFCRTGANFTLRELGLEEVTPPHGTL
YRTDIGLPHCGYSMGASSDADMEADTVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLT
DTEHENTETDHPGGLQNHARLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAP
TDHSLSGEPPAGGAQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILGASR
HDGAYSDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSK
YCNWKCAALSAIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTD
VSLYPSGGTGLETPDRKGKGTTEGKPSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQ
VFIDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGTPR
QSRGAVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGD
CISGTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVAC
SNHGTCIMGTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRAT
CLDQCSGHGTFLPDTGLCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAAC
DQRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLN
GWHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHVNPLCLGSPDP
LDIIQETQVPVSQQNLHSFYDRIKFLVGRDSTHIIPGENPFDRGHACVIRGQVMTSDGTP
LVGVNISFVNNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFV
METIIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEISIS
GCKMRLSYLSSRTPGYKSVLRISLTYPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYY
FIWDKTDVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDK
HHALNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVAL
TCGSDGSLYVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLS
DTNSRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITV
DKFGLIYFVDGAMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAIN
PMDNSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAV
SHNGVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAK
LNTPSSLAVCADGELYVADLGNIRIRFIRKNKPFLNSQNMYELSSPIDQELYLFDTTGKH
LYTQSLPTGDYLYNFTYTGDGDITLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMG
TNSALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSS
FRSDTDSSVHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANG
MEVALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHN
RNLLSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAG
IQRGIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDHLSS
VTMPNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYG
KLSKLAETLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEG
MVNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIIT
TAVMTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYE
YDADGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKM
DEDGFLRQRGGDIFEYNSAGLLIKAYNRAGGWSVRYRYDGLGRRVSSKSSHSHHLQFFYA
DLTNPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGL
MIKQILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHEL
WKHLSSSNIMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMD
AMEPSYELIHTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPK
TKKFASSGSVFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVD
THYFVKPGPSEGDLAILGLSGGRRTLENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCL
NTRYGTTLDEEKVRVLELARQRAVRQAWAREQQRLREGEEGLRAWTEGEKQQVLSTGQVQ
GYDGFFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences H2NET3
ENSPPYP00000004257 ENSPPYP00000004257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]