SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004335 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000004335
Domain Number - Region: 73-148
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004335   Gene: ENSPPYG00000003790   Transcript: ENSPPYT00000004509
Sequence length 499
Comment pep:known_by_projection chromosome:PPYG2:11:91811252:91857230:1 gene:ENSPPYG00000003790 transcript:ENSPPYT00000004509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASVSAASGSHLSNSLAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLA
YPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKN
EESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQT
HVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLET
NRLIFEDKATPHVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEEL
SEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRK
YQAQLEKQKLEKQKKELKATKKTLEEGNSSSRSGITGTTNKKDFTKLRPGEKRRKNLQLL
KDMQSIQNSLQSSSLCWDY
Download sequence
Identical sequences H2NF07
ENSPPYP00000004335 9600.ENSPPYP00000004335 ENSPPYP00000004335 XP_002822417.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]