SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004373 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004373
Domain Number 1 Region: 102-376
Classification Level Classification E-value
Superfamily Caspase-like 3.44e-80
Family Caspase catalytic domain 0.0000000403
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily DEATH domain 3.65e-16
Family Caspase recruitment domain, CARD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004373   Gene: ENSPPYG00000003824   Transcript: ENSPPYT00000004548
Sequence length 377
Comment pep:known_by_projection chromosome:PPYG2:11:101386130:101410873:-1 gene:ENSPPYG00000003824 transcript:ENSPPYT00000004548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGNHRKKPLKMLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
IQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFAARPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSPENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN
Download sequence
Identical sequences H2NF44
ENSPPYP00000004373 ENSPPYP00000004373 9600.ENSPPYP00000004373 XP_009245284.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]