SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004435 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004435
Domain Number 1 Region: 420-647
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.07e-79
Family CAT-like 0.000024
Further Details:      
 
Domain Number 2 Region: 217-310
Classification Level Classification E-value
Superfamily Single hybrid motif 1.44e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00000207
Further Details:      
 
Domain Number 3 Region: 91-186
Classification Level Classification E-value
Superfamily Single hybrid motif 1.14e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000295
Further Details:      
 
Domain Number 4 Region: 349-394
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000000314
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004435   Gene: ENSPPYG00000003872   Transcript: ENSPPYT00000004610
Sequence length 647
Comment pep:known_by_projection chromosome:PPYG2:11:108769363:108807763:1 gene:ENSPPYG00000003872 transcript:ENSPPYT00000004610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRCYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPTPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPAGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIAND
VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
Download sequence
Identical sequences H2NFA4
ENSPPYP00000004435 XP_002822510.1.23681 ENSPPYP00000004435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]