SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004522 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000004522
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family HkH motif-containing C2H2 finger 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004522   Gene: ENSPPYG00000003948   Transcript: ENSPPYT00000004700
Sequence length 331
Comment pep:known_by_projection chromosome:PPYG2:11:115941004:115957180:1 gene:ENSPPYG00000003948 transcript:ENSPPYT00000004700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEH
ERCCWCLCCGCEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFL
VTPQDYARFKKSMVKGLDSYEEKEDEVIKEMAAQIREVEQSRQEVVRSVLEPQTVPDPEE
GSSAHGSWKGINSQVASSSQQPANLDLPPAPELDWMETGPSLTFIGHQDIPGVGNIHSGA
TPPWMIQDEYTAGNQEIGPSYEEFLKEKEKQKLKKLPPDRVGANFDHSSRTSAGWLPSFG
RVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS
Download sequence
Identical sequences H2NFI8
ENSPPYP00000004522 XP_002822610.1.23681 9600.ENSPPYP00000004522 ENSPPYP00000004522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]