SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004539 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000004539
Domain Number - Region: 19-74
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00889
Family Intermediate filament protein, coiled coil region 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004539   Gene: ENSPPYG00000003961   Transcript: ENSPPYT00000004717
Sequence length 123
Comment pep:known_by_projection chromosome:PPYG2:11:116138051:116140923:-1 gene:ENSPPYG00000003961 transcript:ENSPPYT00000004717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQCHALQEDMQTRSKQLEEEVKGLQGQLEACQREAAAAQEEAEQALGERDQALAQLRA
HVADMEAKYEEILHDSLDRLLAKLRAIKLQWDGAALRLHARHKEQLRQFGLTPGSLRPPA
PSL
Download sequence
Identical sequences H2NFK4
ENSPPYP00000004539 ENSPPYP00000004539 9600.ENSPPYP00000004539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]