SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004614 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000004614
Domain Number - Region: 134-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004614   Gene: ENSPPYG00000004036   Transcript: ENSPPYT00000004795
Sequence length 201
Comment pep:known_by_projection chromosome:PPYG2:11:122686602:122695351:-1 gene:ENSPPYG00000004036 transcript:ENSPPYT00000004795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMFLLLMSLYLLGSARGTSGQPDELSGSIDHQTSVQQLPGEPAATEHAEGEHTVGEQPS
GEQPSGEHLSGEQPLSEHESGEQPSDEQPSGEHASGEQPSGEHASGEQSLGEHALSEKPS
GEQASGAPISSTSTGTILNCYTCAYMNDRGRCLRGEGTCITQNSQQCMLKKIFEGGKLQF
MVQGCEMCPSMNLFSHGTRMQ
Download sequence
Identical sequences H2NFS9
9600.ENSPPYP00000004614 ENSPPYP00000004615 ENSPPYP00000004614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]