SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004626 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004626
Domain Number 1 Region: 42-186,243-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000142
Family FAD-linked reductases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004626   Gene: ENSPPYG00000004046   Transcript: ENSPPYT00000004807
Sequence length 313
Comment pep:known_by_projection chromosome:PPYG2:11:123326279:123335088:1 gene:ENSPPYG00000004046 transcript:ENSPPYT00000004807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRRVLPHGLGRGLLTRKPGTRRGGFSLCQQSLPENIQLSLFSASFLRNINEYLAVVDAP
PLDLRFSPSGYLLLASEKDAAAMESNVKVQRQVGAKISLMSPDQLRNKFPWINTEGVALA
SYAQIAALAGIGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRRE
GLGSNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRIPAFETLKVQSAWAGYYDY
NTFDQNGVVGPHPLVANMYFATGFSGHGLQQAPGVGRAVAEMILKGRFQTIDLSPFLFTR
FYLGEKIQENNII
Download sequence
Identical sequences H2NFU1
9600.ENSPPYP00000004626 ENSPPYP00000004626 ENSPPYP00000004626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]