SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004643 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004643
Domain Number 1 Region: 635-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000109
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 524-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 593-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000195
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number 4 Region: 219-335
Classification Level Classification E-value
Superfamily SET domain 0.0000763
Family Histone lysine methyltransferases 0.084
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004643
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000136
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 767-791,825-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000245
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 688-753
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00124
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004643   Gene: ENSPPYG00000004061   Transcript: ENSPPYT00000004824
Sequence length 1156
Comment pep:known chromosome:PPYG2:11:127064287:127169678:-1 gene:ENSPPYG00000004061 transcript:ENSPPYT00000004824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKDESSHVWPTSAEHEQNAAQVHFVPDTGTVAQIVYTDDQVRPPQQVVYTADGASYTS
VDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQTPLGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWEPDPPRPFDPHDLWCEECNN
AHSSVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRGSELKDCYIHLKVSLDKGDRKDRDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRTRGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKSDDGTQDLLHFPTKEQFDEAEPATLNGLDQPEQTTIPIPQLPQETQSSLEHEPETHT
LHLQPQHEESVVPTQSTLTADDMRRAKRIRNAALQHLFIRKSFRPFKCLQCGKAFREKDK
LDQHLRFHGREGNCPLTCDLCNKGFISSASLESHMKLHSDQKTYSCIFCPESFDRLDLLK
DHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLRLHML
RHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITSTDYDS
FTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKVYKSA
SKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYS
SKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMT
ELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVAPATSPHQSQQSTVD
VGQLHDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSS
STQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVT
TGQVKAVTSGHYVLSESQSDLEEKQTSALSGGVQVQPPAHSDSLDPQTTSQQQTTQYIIT
TTTNGNGSSEVHITKP
Download sequence
Identical sequences H2NFV8
ENSPPYP00000004643 XP_009245530.1.23681 ENSPPYP00000004643 9600.ENSPPYP00000004643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]