SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004672 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004672
Domain Number 1 Region: 215-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-54
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000116
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 890-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000863
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 4 Region: 839-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004672   Gene: ENSPPYG00000004094   Transcript: ENSPPYT00000004857
Sequence length 950
Comment pep:known_by_projection chromosome:PPYG2:11_random:637072:664596:1 gene:ENSPPYG00000004094 transcript:ENSPPYT00000004857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWGGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFATEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRVGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKFCLKGACVERHNLNKHRVDGSWAKWEPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSASCGSGLQKRAVDCRGSPGQRTVPACDAAHRPLETQACGEPCPTWELS
AWSPCSKSCGRGFKRRPLKCVGHGGRLLARDQCNLRRKPQELDFCVLRPC
Download sequence
Identical sequences H2NFY7
ENSPPYP00000004672 XP_002833683.1.23681 ENSPPYP00000004672 9600.ENSPPYP00000004672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]