SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004688 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004688
Domain Number 1 Region: 16-228,274-451
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000000109
Family LacY-like proton/sugar symporter 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004688   Gene: ENSPPYG00000004110   Transcript: ENSPPYT00000004873
Sequence length 456
Comment pep:known chromosome:PPYG2:11_random:3336299:3346765:-1 gene:ENSPPYG00000004110 transcript:ENSPPYT00000004873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGASNSTARILSTNHTG
PEDAFNFNNWVTLLSQLPLLLFTFLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVD
MSPGPFFSITMASVCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLL
SMASGVDAETSALGYFITPCVGILMSIMCYLSLPHLKFARYYLANKPSQAQAQELETKAE
LLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLV
FTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSYFLWPDEDSRL
LPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
Download sequence
Identical sequences H2NG03
ENSPPYP00000004688 XP_009234371.1.23681 9600.ENSPPYP00000004688 ENSPPYP00000004688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]