SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004763 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004763
Domain Number 1 Region: 1466-1657
Classification Level Classification E-value
Superfamily vWA-like 7.95e-46
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 2 Region: 1270-1460
Classification Level Classification E-value
Superfamily vWA-like 8.42e-44
Family Integrin A (or I) domain 0.0000000121
Further Details:      
 
Domain Number 3 Region: 1650-1872
Classification Level Classification E-value
Superfamily vWA-like 1.4e-38
Family Integrin A (or I) domain 0.0000000429
Further Details:      
 
Domain Number 4 Region: 647-708
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000137
Family ATI-like 0.097
Further Details:      
 
Domain Number 5 Region: 294-348
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000036
Family BSTI 0.039
Further Details:      
 
Domain Number 6 Region: 772-828
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000018
Family ATI-like 0.014
Further Details:      
 
Domain Number 7 Region: 1142-1195
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000213
Family ATI-like 0.033
Further Details:      
 
Domain Number 8 Region: 2515-2595
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000816
Family VWC domain 0.059
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000004763
Domain Number - Region: 826-893
Classification Level Classification E-value
Superfamily FnI-like domain 0.000126
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 2368-2444
Classification Level Classification E-value
Superfamily FnI-like domain 0.000596
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 698-739
Classification Level Classification E-value
Superfamily FnI-like domain 0.00523
Family VWC domain 0.034
Further Details:      
 
Domain Number - Region: 440-512
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.00746
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004763   Gene: ENSPPYG00000004180   Transcript: ENSPPYT00000004952
Sequence length 2758
Comment pep:known_by_projection chromosome:PPYG2:12:6121603:6314889:-1 gene:ENSPPYG00000004180 transcript:ENSPPYT00000004952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPARFAGVLLALALILPGTLCAEGTRGRSSMARCSLFGSDFINTFDGSMYSFAGYCSYL
LAGDCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECTCPAFLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YKQCVSPCARTCQSLHINEVCQERCVDGCSCPEGQLLDEGLCMESTKCPCMHSGKRYPPG
ASLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTVRLPGLQDSLVKLKHGGGVAMDGQDVQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDLIPSGL
AEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSP
LPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQC
GTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDI
FSDHHTMCYCEDGFMHCTMNGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNP
RAEGLECAKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGET
VKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYMFPGECQYVLVQDYCGSN
PGTFRILVGNEGCSHPSVKCEKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRY
IILLLGKALSVVWDHHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDF
GNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYL
DVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPRSCEERNLRENGYE
CEWRYNSCAPACRVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEV
AGRRFASGKKVTLNPSDPEHCQICHCDGVNLTCEACQEPGGLVVPPTDAPVSPTTPYVED
ISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEY
HDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIA
LLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLS
GVDELEQQRDEMVSYLCDLAPEARPPTLPPHMAQVTVGPGLLGVSTLGPKRNSMVLDVAF
VLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGDI
LQRVREIRYQGGNRTNTGLALQYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLPG
DIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTLS
PAADCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPHLTQVSVLQYGSITTI
DVPWNVAPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGVSKAVVILVT
DISVDSVDAAADAARSNRVAVFPIGIGDRYDAAQLRILAGPAGDSNMVKLQRIEDLPTMV
TLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDR
GPRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKE
QDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVMVNGRLVSVPYVGGNMEVN
VYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFILRDG
TVTTDWKTLVQEWTVQRPGQMCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYA
ICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCGTQCIGEDGVQHQFLEAWVPDH
QPCQICTCLSGRKVNCTTQPCPTAKDLTCGLCEVARLRQNADQCCPEYECVCDLVSCDLP
PVPHCEGGLQPTLTNPGECRPNFICACRKEECERVSPPSCPPHRLPTLRKTQCCDEYECA
CNCVNSTVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTD
MEDAVMGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWK
SVGSQWASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCR
CERVEACTLNGTIIGPGKSVMIDVCTTCRCVVQVGVISGFKLECRKTTCNPCPLGYKEED
NTGECCGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPP
FDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCA
SKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Download sequence
Identical sequences H2NG74
9600.ENSPPYP00000004763 ENSPPYP00000004763 ENSPPYP00000004763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]