SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004983 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004983
Domain Number 1 Region: 507-585
Classification Level Classification E-value
Superfamily HMG-box 1.05e-25
Family HMG-box 0.00000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004983   Gene: ENSPPYG00000004363   Transcript: ENSPPYT00000005178
Sequence length 715
Comment pep:known_by_projection chromosome:PPYG2:12:24548903:25074594:-1 gene:ENSPPYG00000004363 transcript:ENSPPYT00000005178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHEVDGNKVMSSFAPHNSST
SPQKAEEGGRQSGESLSSTALGTPERRKGSLADVVDTLKQRKMEELIKNEPEETPSIEKL
LSKDWKDKLLAMGSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQLLAAHDEQKKLAA
SQIEKQRQQMELAKQQQEQIARQQQQLLQQQHKINLLQQQIQVQGQLPPLMIPVFPPDQR
TLAAAAQQGFLLPPGFSYKAGCSDPYPVQLIPTTMAAAAAATPGLGPLQLQQLYAAQLAA
MQVSPGGKLPGIPQGNLGAAVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKS
PTSPTSPHMPALRINSGAGPLKASVPAALASPSARVSTIGYLNDHDAVTKAIQEARQMKE
QLRREQQVLDGKVAVVNSLGLNNCRTEKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS
GDSDGSAGVSESRIYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISK
ILGSRWKAMTNLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAI
MRNRRQEMRQYFNVGQQAQIPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPV
IQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYGSDSENHIAGQAN
Download sequence
Identical sequences H2NGT8 T2CZM2
ENSPPYP00000004983 ENSPPYP00000004983 XP_007966121.1.81039 XP_009245821.1.23681 XP_010373760.1.97406 XP_011757363.1.29376 XP_011913701.1.92194 XP_012312573.1.9421 XP_015006776.1.72884 XP_015285987.1.63531 XP_016780402.1.37143 XP_016875387.1.92137 XP_016875388.1.92137 XP_016875389.1.92137 XP_016875390.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]