SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004990 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004990
Domain Number 1 Region: 41-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000000732
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004990   Gene: ENSPPYG00000004372   Transcript: ENSPPYT00000005187
Sequence length 265
Comment pep:known_by_projection chromosome:PPYG2:12:27126143:27128714:-1 gene:ENSPPYG00000004372 transcript:ENSPPYT00000005187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEVEARTDREKGKGXXXXXXXX
Download sequence
Identical sequences H2NGU4
ENSPPYP00000004990 ENSPPYP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]