SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005039 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005039
Domain Number 1 Region: 77-411
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.1e-55
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 
Domain Number 2 Region: 495-605
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000000536
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005039
Domain Number - Region: 436-466
Classification Level Classification E-value
Superfamily Plexin repeat 0.0471
Family Plexin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005039   Gene: ENSPPYG00000004415   Transcript: ENSPPYT00000005237
Sequence length 647
Comment pep:known_by_projection chromosome:PPYG2:12:39091032:39449878:-1 gene:ENSPPYG00000004415 transcript:ENSPPYT00000005237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKASENVEYTLRSLSSLMGERRRKQQEPDAASAAGECSLLAAAESSTSLQSAGAGGGG
VGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQ
ELLVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLV
VGLGIGIASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRY
MLGLAAIPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIE
EEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDD
RLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAW
GRCENETKFTEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWAR
STGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKK
LEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Download sequence
Identical sequences H2NGZ3
ENSPPYP00000005039 9600.ENSPPYP00000005039 ENSPPYP00000005039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]