SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005085 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005085
Domain Number 1 Region: 283-683
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.83e-104
Family Phosphofructokinase 0.00000727
Further Details:      
 
Domain Number 2 Region: 1-283
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.16e-87
Family Phosphofructokinase 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005085   Gene: ENSPPYG00000004453   Transcript: ENSPPYT00000005285
Sequence length 710
Comment pep:novel chromosome:PPYG2:12:47769258:47781452:1 gene:ENSPPYG00000004453 transcript:ENSPPYT00000005285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRFEVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARC
KDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEE
ATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMG
RHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDK
NGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILTKDVTKAMDEKKFDEAL
KLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGN
RVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQ
GLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICT
TCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEH
LVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPF
DRNFATKMGAIEAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVTELKDQT
DFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV
Download sequence
Identical sequences H2NH38
ENSPPYP00000005085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]