SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005095 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005095
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 6.88e-46
Family C-type lysozyme 0.000000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005095   Gene: ENSPPYG00000004463   Transcript: ENSPPYT00000005296
Sequence length 142
Comment pep:known_by_projection chromosome:PPYG2:12:48221846:48223930:-1 gene:ENSPPYG00000004463 transcript:ENSPPYT00000005296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFFVPLFLVGILFPAIQAKQFTKCELSQLLKDIDGYGGIALPELICTVFHTSGYDTQAI
AENNESMEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
DYWLAHKALCTEKLEQWLCEKL
Download sequence
Identical sequences H2NH48
XP_002823206.1.23681 ENSPPYP00000005095 ENSPPYP00000005095 9600.ENSPPYP00000005095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]