SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005185 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005185
Domain Number 1 Region: 351-428
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.59e-22
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 121-155
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000251
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005185
Domain Number - Region: 158-229
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000628
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 
Domain Number - Region: 258-352
Classification Level Classification E-value
Superfamily Prefoldin 0.00497
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005185   Gene: ENSPPYG00000004544   Transcript: ENSPPYT00000005387
Sequence length 506
Comment pep:known_by_projection chromosome:PPYG2:12:52057260:52064658:-1 gene:ENSPPYG00000004544 transcript:ENSPPYT00000005387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCRSYRISSGCGVTRNFSSCSVAPKTGNRCCISAAPYRGVSCYRGLTGFGSRSLCNLGS
CGPRIAVGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQ
EEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKWQFYQNQRCCESNLEPLFSGYIETLRR
EAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVVLKKDVDCAYLRKSD
LEANVEALVEESSFLRRLYEEEIRVLQAHISDTSVIVKMDNSRDLNMDCIVAEIKAQYDD
VASRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEIENAKCQRA
KLEAAVAEAEQQGEAALSDARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDIEIA
TYRRLLEGEEHRLCEGVGSVNVCVSSSRGGVSCGGLSYSSTPGRQITSGPSAIGGSITVV
APDSCVPCQPRSSSFSCGSSRSVRFA
Download sequence
Identical sequences H2NHD3
ENSPPYP00000005185 9600.ENSPPYP00000005185 ENSPPYP00000005185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]