SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005186 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005186
Domain Number 1 Region: 349-426
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.14e-22
Family Intermediate filament protein, coiled coil region 0.00069
Further Details:      
 
Domain Number 2 Region: 119-153
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000785
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Domain Number 3 Region: 156-227
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000012
Family Intermediate filament protein, coiled coil region 0.009
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005186
Domain Number - Region: 248-350
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005186   Gene: ENSPPYG00000004545   Transcript: ENSPPYT00000005388
Sequence length 513
Comment pep:known_by_projection chromosome:PPYG2:12:52092812:52103944:-1 gene:ENSPPYG00000004545 transcript:ENSPPYT00000005388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGGGLRALGCLGSQSLCNV
GFGRPQVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDE
KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISTLRRQL
DCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLE
TNAEALVQEIDFLKGLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIA
SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQEIENVKAQRCKL
EGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY
RRLLEGEEHRLCEGIGPVNISVSSSKGTFLYEPCGVSTPVLSTGVLRSSGGCSIVGTGEL
YVPCKPQGLLSCGSGRNSSTKLGAGGSSPSHKC
Download sequence
Identical sequences H2NHD4
XP_002823306.1.23681 9600.ENSPPYP00000005186 ENSPPYP00000005186 ENSPPYP00000005186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]