SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005214 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005214
Domain Number 1 Region: 146-390
Classification Level Classification E-value
Superfamily vWA-like 1.49e-81
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 378-480
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-24
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 3 Region: 643-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000119
Family Integrin beta tail domain 0.0081
Further Details:      
 
Domain Number 4 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000023
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 601-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Integrin beta EGF-like domains 0.0076
Further Details:      
 
Domain Number 6 Region: 559-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005214
Domain Number - Region: 530-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005214   Gene: ENSPPYG00000004571   Transcript: ENSPPYT00000005417
Sequence length 797
Comment pep:known_by_projection chromosome:PPYG2:12:52963234:52973436:-1 gene:ENSPPYG00000004571 transcript:ENSPPYT00000005417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLPVVLVLLLVLSRGESELDAKIPSTGDATERRNPHLSLLGSCQPASSCQKCILSHPS
CAWCKQLNFTALGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVR
LQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQA
FEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLG
GIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSK
LIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREGK
AEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDT
QSQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKG
HCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGD
MDSCISPEGELCSGHGRCKCNRCQCSDGYYGALCDQCPGCKTPCERHRDCAECGAFGTGP
LATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGRVVLRVRPQEKGA
DHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSA
ITTTINPRFQEADSPTL
Download sequence
Identical sequences H2NHG2
ENSPPYP00000005214 9600.ENSPPYP00000005214 ENSPPYP00000005214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]