SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005251 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005251
Domain Number 1 Region: 31-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000364
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 
Domain Number 2 Region: 237-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000775
Family Classic zinc finger, C2H2 0.079
Further Details:      
 
Domain Number 3 Region: 182-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000679
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005251   Gene: ENSPPYG00000004603   Transcript: ENSPPYT00000005455
Sequence length 386
Comment pep:known_by_projection chromosome:PPYG2:12:54151544:54174217:-1 gene:ENSPPYG00000004603 transcript:ENSPPYT00000005455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSH
TFGGPLLKTKRPVISCNVCQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREP
GDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGT
PAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIKA
YPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHRDGVAGKPNPLLSRH
KKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPAPAAPLLQGP
PITHPLLHPAPGPIRTAHGPILFSPY
Download sequence
Identical sequences H2NHJ8
ENSPPYP00000005251 ENSPPYP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]