SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005252 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005252
Domain Number 1 Region: 91-518
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-91
Family Integrin alpha N-terminal domain 0.000000000583
Further Details:      
 
Domain Number 2 Region: 818-1031
Classification Level Classification E-value
Superfamily Integrin domains 1.6e-50
Family Integrin domains 0.0000437
Further Details:      
 
Domain Number 3 Region: 520-676
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-42
Family Integrin domains 0.0000133
Further Details:      
 
Domain Number 4 Region: 677-811
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-33
Family Integrin domains 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005252   Gene: ENSPPYG00000004604   Transcript: ENSPPYT00000005456
Sequence length 1078
Comment pep:known_by_projection chromosome:PPYG2:12:54177544:54202478:-1 gene:ENSPPYG00000004604 transcript:ENSPPYT00000005456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTSESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQVNLVQGQLQTRQASSIYDDSY
LGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVT
ATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYIYLQHPAGIEPTPTLTLTGHDEFGR
FGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGGLGSKPSQVLQPLWAASH
TPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEER
SCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRALFLASRQATLT
QTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYHS
NSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEA
ELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTV
PHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWH
PRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVMGLNCTT
NHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQES
QSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPQQLPQKERHVATAVQWTKA
EGSHGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences H2NHJ9
ENSPPYP00000005252 ENSPPYP00000005252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]