SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005262 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005262
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005262   Gene: ENSPPYG00000004613   Transcript: ENSPPYT00000005466
Sequence length 331
Comment pep:known_by_projection chromosome:PPYG2:12:54785813:54788674:1 gene:ENSPPYG00000004613 transcript:ENSPPYT00000005466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTYVKSKEMGELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE
Download sequence
Identical sequences A0A2K6KRJ9 A0A2K6N9C6 H2NHK9
ENSPPYP00000005262 9600.ENSPPYP00000005262 XP_010355873.1.97406 XP_017712849.1.44346 ENSPPYP00000005262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]