SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005272 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005272
Domain Number 1 Region: 76-265,310-559
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-75
Family Integrin alpha N-terminal domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 889-1071
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-39
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 559-725
Classification Level Classification E-value
Superfamily Integrin domains 2.41e-33
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 4 Region: 726-878
Classification Level Classification E-value
Superfamily Integrin domains 7.59e-23
Family Integrin domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005272   Gene: ENSPPYG00000004626   Transcript: ENSPPYT00000005479
Sequence length 1128
Comment pep:known_by_projection chromosome:PPYG2:12:55436434:55458033:-1 gene:ENSPPYG00000004626 transcript:ENSPPYT00000005479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRRLKDQRDFGDQRRPWGDLGLGACESSLAFAGSARGDRPMAGARSRDPWGASGICYL
FGSLLVELLFSRAVAFNLDVMGALLKEGEPGSLFGFSVALHRQLQPQPQSWLLVGAPQAL
ALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIV
TCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQ
QGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSVDLAHLDDGPYEAGGEKEQDPRL
IPVPANSYFGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLV
HAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGW
PDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQD
GFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGIKSFGYSLSGGLDMDGNQY
PDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAV
PSSYSPTVALDYVLDADTDRRLRGQVPRVTFPSRNPEEPKHQASGTVWLKHQHDRVCGDA
MFQLQENVKDKLRAIVVTLSYSLQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLK
QGCGEDKICQSNLQLVRARFCTRISDTEFQPLPMDADGTTALFALSGQPVIGLELMVTNL
PSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPM
KRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVSARARVFIELPLSIAGMAI
PQQLFFSGVVRGERAMQSEWDVGSKVKYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKW
LLYPVRVELEGGQGPGQKGLCSPRPNILHLDVSRDRRRRELEPPEQQEPGEQQEPSMSWW
PVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVWGRLWNSTFLECGFFHRSSQ
SSSFPTNYHRACLAVQPSAMEVGGPGTVGWDSSNGRSTPRPPCPSTMR
Download sequence
Identical sequences H2NHL9
ENSPPYP00000005272 ENSPPYP00000005272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]