SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005417 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005417
Domain Number 1 Region: 14-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.24e-79
Family Pancreatic carboxypeptidases 0.000000000223
Further Details:      
 
Domain Number 2 Region: 314-376
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.94e-18
Family Carboxypeptidase regulatory domain 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005417   Gene: ENSPPYG00000004755   Transcript: ENSPPYT00000005628
Sequence length 395
Comment pep:known chromosome:PPYG2:12:69101828:69201713:-1 gene:ENSPPYG00000004755 transcript:ENSPPYT00000005628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPCLWLGLLLPWVAALDFNYHHQEGMEAFLKTVAQNYSSITHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVSGHDPHLTKLLSFACKRGQDEFCLTSLMS
Download sequence
Identical sequences H2NI03
ENSPPYP00000005417 ENSPPYP00000005417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]