SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005420 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000005420
Domain Number - Region: 164-221
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005420   Gene: ENSPPYG00000004758   Transcript: ENSPPYT00000005631
Sequence length 227
Comment pep:known_by_projection chromosome:PPYG2:12:69621674:69651519:1 gene:ENSPPYG00000004758 transcript:ENSPPYT00000005631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Download sequence
Identical sequences A0A096MWX6 A0A0D9QW36 A0A2K5EA50 A0A2K5JJ79 A0A2K5MFR5 A0A2K5SGA9 A0A2K5Y3I8 A0A2K6BYL0 A0A2K6QFZ2 A0A2K6UUT6 F7HFQ0 G1QUL7 G3RYG4 G7N7M0 G7PI06 H2NI06 H2Q6F9 O95619
ENSNLEP00000004637 ENSCJAP00000003190 GO.37707 ENSPANP00000004385 ENSP00000247843 9598.ENSPTRP00000008837 9600.ENSPPYP00000005420 9606.ENSP00000247843 ENSNLEP00000004637 ENSPPYP00000005420 ENSP00000247843 ENSCJAP00000003190 ENSPTRP00000008837 NP_006521.1.87134 NP_006521.1.92137 XP_001155404.1.37143 XP_002752793.1.60252 XP_002823551.1.23681 XP_003259548.1.23891 XP_003808769.1.60992 XP_003927829.1.74449 XP_005571566.1.63531 XP_008002173.1.81039 XP_010357042.1.97406 XP_011725504.1.29376 XP_011784685.1.43180 XP_011831995.1.47321 XP_011905049.1.92194 XP_012296700.1.9421 XP_015007723.1.72884 XP_017364769.1.71028 XP_018894474.1.27298 Hs5729838___KOG3149 ENSPPYP00000005420 ENSP00000247843 ENSPTRP00000008837 gi|5729838|ref|NP_006521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]