SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005474 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005474
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005474   Gene: ENSPPYG00000004800   Transcript: ENSPPYT00000005687
Sequence length 255
Comment pep:known_by_projection chromosome:PPYG2:12:81220172:81222156:1 gene:ENSPPYG00000004800 transcript:ENSPPYT00000005687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS
TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDPASLSPVASTDSQP
ATPGASGSRLIYHVL
Download sequence
Identical sequences H2NI60
ENSPPYP00000005474 XP_002823592.1.23681 9600.ENSPPYP00000005474 ENSPPYP00000005474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]