SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005575 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005575
Domain Number 1 Region: 121-195
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005575   Gene: ENSPPYG00000004884   Transcript: ENSPPYT00000005789
Sequence length 235
Comment pep:known_by_projection chromosome:PPYG2:12:104687816:104688523:1 gene:ENSPPYG00000004884 transcript:ENSPPYT00000005789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVA
RRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVS
AAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Download sequence
Identical sequences H2NIF7
9600.ENSPPYP00000005575 XP_002823706.1.23681 ENSPPYP00000005575 ENSPPYP00000005575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]